Longevity & Cellular HealthIn StockLongevity & Cellular Health
FOXO4-DRI
Also known as: FOXO4-D-Retro-Inverso peptide
Synthetic D-retro-inverso peptide designed as a selective senolytic research tool targeting the FOXO4–p53 interaction.
FOXO4-DRI is a synthetic peptide engineered to disrupt the interaction between the transcription factor FOXO4 and the tumor suppressor p53 in senescent cells.
Constructed as a D-retro-inverso isomer (mirror-image D-amino acid residues in reversed sequence), it was published in the journal Cell in 2017 by de Keizer and colleagues as a research tool for senolytic biology.The preclinical research literature has characterized FOXO4-DRI's ability to selectively induce apoptosis in p16-positive senescent cells while sparing non-senescent cells in cell-culture and animal-model contexts.
Reported reductions in senescent-cell burden of roughly 25–30% within 10 days of dosing in animal models have made it one of the most cited senolytic peptide tools.Due to the synthesis complexity of all-D-amino-acid peptides, FOXO4-DRI is priced at a premium relative to conventional peptide synthesis products.
Research applications
- Cellular senescence and senolytic research
- FOXO4–p53 protein-protein interaction biology
- D-retro-inverso peptide chemistry and stability
- Aging-hallmark research (Lopez-Otin framework)
- p16-positive cell clearance models
Technical profile
- Net content
- 10 mg
- Molecular formula
- C228H388N86O64
- Molecular weight
- 5358.05 g/mol
- CAS
- 2460055-10-9
- Sequence
- LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
For research use only. Not for human or veterinary consumption. Not intended to diagnose, treat, cure, or prevent any disease. Catalog availability restricted to verified licensed practitioners.
FOXO4-DRI is a cell-penetrating peptide that disrupts the FOXO4-p53 interaction, selectively inducing apoptosis in senescent cells. Research demonstrates its senolytic properties may reverse aspects of aging by clearing dysfunctional cells.
