Growth Hormone AxisIn StockGrowth Hormone Axis
Sermorelin
Also known as: GRF(1-29), Growth-hormone-releasing factor 1-29 NH2
Synthetic 29-amino-acid N-terminal fragment of human growth-hormone-releasing hormone (GHRH).
Sermorelin is a synthetic peptide consisting of the first 29 amino acids of human growth-hormone-releasing hormone (GHRH).
The N-terminal fragment retains full biological activity of native GHRH at the GHRH receptor (GHRHR), making it a standard reference compound in pituitary somatotroph research.In the research literature, Sermorelin is used to probe GHRHR-mediated signaling, downstream cAMP/PKA pathway activation, and growth-hormone secretion dynamics in both in-vitro pituitary-cell models and in-vivo animal studies.
It is also a frequent comparison compound for newer GHRH analogs such as CJC-1295 and Tesamorelin.Sermorelin was previously marketed as a pharmaceutical (Geref) under a specific clinical indication.
Novera supplies it strictly as research-grade material for laboratory investigation.
Research applications
- GHRH receptor pharmacology and signaling
- Pituitary somatotroph cell-biology research
- Comparative studies with longer-acting GHRH analogs
- Neuroendocrine regulation of the GH/IGF-1 axis
- Endocrine feedback loop modeling
Technical profile
- Net content
- 10 mg
- Molecular formula
- C149H246N44O42S
- Molecular weight
- 3357.96 g/mol
- CAS
- 86168-78-7
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
For research use only. Not for human or veterinary consumption. Not intended to diagnose, treat, cure, or prevent any disease. Catalog availability restricted to verified licensed practitioners.
Sermorelin is a synthetic 29-amino-acid analogue of GHRH representing the shortest fully functional fragment. It stimulates physiological GH secretion from the pituitary and is studied for age-related GH decline, sleep quality, and body composition.
